HPA019803

CCDC171 antibody from Sigma-Aldrich
bA536D16.1, bA778P13.1, C9orf93, Em:AL513423.1, FLJ39267, FLJ46740
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019803
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019803, RRID:AB_1845846
Product name
Anti-C9orf93 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019803
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf93 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KAQAAQSESELQKLSQAFHKDAEEKLTFLHTLYQH
LVAGCVLIKQPEGMLDKFSWSELCAVLQENVDALI
ADLNRANEKIRHLEYICKNKSDTMREL
Storage
-20C
Provider Type Product Number
- No reagents -