Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057153-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057153-M01, RRID:AB_464380
- Product name
- CTL2 monoclonal antibody (M01), clone 3D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CTL2.
- Antigen sequence
YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGD
CPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYE
DGHGSRKNITDLVEGAKKANGVLEARQLAMRIFED
YTV- Isotype
- IgG
- Antibody clone number
- 3D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Functional expression of choline transporter like-protein 1 (CTL1) and CTL2 in human brain microvascular endothelial cells.
Functional analysis of [methyl-(3)H]choline uptake in glioblastoma cells: Influence of anti-cancer and central nervous system drugs.
Anti-human neutrophil antigen-3a induced transfusion-related acute lung injury in mice by direct disturbance of lung endothelial cells.
Molecular and functional characterization of choline transporter in rat renal tubule epithelial NRK-52E cells.
Iwao B, Yara M, Hara N, Kawai Y, Yamanaka T, Nishihara H, Inoue T, Inazu M
Neurochemistry international 2016 Feb;93:40-50
Neurochemistry international 2016 Feb;93:40-50
Functional analysis of [methyl-(3)H]choline uptake in glioblastoma cells: Influence of anti-cancer and central nervous system drugs.
Taguchi C, Inazu M, Saiki I, Yara M, Hara N, Yamanaka T, Uchino H
Biochemical pharmacology 2014 Apr 1;88(3):303-12
Biochemical pharmacology 2014 Apr 1;88(3):303-12
Anti-human neutrophil antigen-3a induced transfusion-related acute lung injury in mice by direct disturbance of lung endothelial cells.
Bayat B, Tjahjono Y, Sydykov A, Werth S, Hippenstiel S, Weissmann N, Sachs UJ, Santoso S
Arteriosclerosis, thrombosis, and vascular biology 2013 Nov;33(11):2538-48
Arteriosclerosis, thrombosis, and vascular biology 2013 Nov;33(11):2538-48
Molecular and functional characterization of choline transporter in rat renal tubule epithelial NRK-52E cells.
Yabuki M, Inazu M, Yamada T, Tajima H, Matsumiya T
Archives of biochemistry and biophysics 2009 May 1;485(1):88-96
Archives of biochemistry and biophysics 2009 May 1;485(1):88-96
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SLC44A2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SLC44A2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol