HPA027844

HEXD antibody from Sigma-Aldrich
FLJ23825, HEXDC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027844
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027844, RRID:AB_10600711
Product name
Anti-HEXDC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027844
Antibody type
Polyclonal
Antigen
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SARCLPPRCHPPALAGTLLRTPEGRAHARGLLLEA
GGALHCQMAWAIRAHVGVVPSGPAVSCPHSVPEGP
GQPLGERLENTEGSSTGRPAL
Storage
-20C
Provider Type Product Number
- No reagents -