H00008209-M01
antibody from Abnova Corporation
Targeting: GATD3A
C21orf33, D21S2048E, ES1, GT335, HES1, KNP-I, KNP-Ia, KNPH, KNPI
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008209-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008209-M01, RRID:AB_534803
- Product name
- C21orf33 monoclonal antibody (M01), clone 1F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant C21orf33.
- Antigen sequence
RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCV
KEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGA
MVRKVLELTGK- Isotype
- IgG
- Antibody clone number
- 1F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- C21orf33 monoclonal antibody (M01), clone 1F5 Western Blot analysis of C21orf33 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of C21orf33 expression in transfected 293T cell line by C21orf33 monoclonal antibody (M01), clone 1F5.Lane 1: C21orf33 transfected lysate(28.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged C21orf33 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to C21orf33 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol