HPA003229

FAM117B antibody from Atlas Antibodies
ALS2CR13, FLJ38771
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003229
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003229, RRID:AB_2246696
Product name
Anti-FAM117B
Provider product page
Atlas Antibodies - HPA003229
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVS
ILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIA
VASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEE
AE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -