HPA003229

FAM117B antibody from Sigma-Aldrich
ALS2CR13, FLJ38771
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003229
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003229, RRID:AB_2246696
Product name
Anti-FAM117B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003229
Antibody type
Polyclonal
Antigen
Protein FAM117B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECSPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVS
ILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIA
VASLSTNTEQDRVSRGTSTVMPSASLLPPPEPIEE
AE
Storage
-20C
Provider Type Product Number
- No reagents -