Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA020923 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA020923, RRID:AB_1852963
- Product name
- Anti-LMO7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKS
QLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEERE
EIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPS
RRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEK
GATY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The emerin-binding transcription factor Lmo7 is regulated by association with p130Cas at focal adhesions.
The interactome of LIM domain proteins: The contributions of LIM domain proteins to heart failure and heart development
Wozniak MA, Baker BM, Chen CS, Wilson KL
PeerJ 2013;1:e134
PeerJ 2013;1:e134
The interactome of LIM domain proteins: The contributions of LIM domain proteins to heart failure and heart development
Li A, Ponten F, dos Remedios C
PROTEOMICS 2012 January;12(2):203-225
PROTEOMICS 2012 January;12(2):203-225
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines HeLa and HEK293 using Anti-LMO7 antibody. Corresponding LMO7 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to cytosol & actin filaments.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows both membranous and nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows moderate nuclear and cytoplasmic positivity in striated muscle fibers.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human uterine cervix shows moderate nuclear and membranous positivity in squamous epithelial cells.
- Sample type
- HUMAN
