HPA020923

LMO7 antibody from Atlas Antibodies
FBX20, FBXO20, KIAA0858
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020923
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020923, RRID:AB_1852963
Product name
Anti-LMO7
Provider product page
Atlas Antibodies - HPA020923
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKS
QLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEERE
EIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPS
RRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEK
GATY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -