HPA020923

LMO7 antibody from Sigma-Aldrich
FBX20, FBXO20, KIAA0858
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020923, RRID:AB_1852963
Product name
Anti-LMO7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020923
Antibody type
Polyclonal
Antigen
LIM domain only protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKS
QLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEERE
EIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPS
RRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEK
GATY
Storage
-20C
Provider Type Product Number
- No reagents -