HPA003445

SCHIP1 antibody from Sigma-Aldrich
SCHIP-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003445
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003445, RRID:AB_1079875
Product name
Anti-SCHIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003445
Antibody type
Polyclonal
Antigen
Schwannomin interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNSTKVTPCSECKSSSSPGGSLDLVSALEDYEEPF
PVYQKKVIDEWAPEEDGEEEEEEDERDQRGYRDDR
SPAREPGDVSARTRSGGGGGRSATTAMPPPVPNGN
LHQHDPQDLRHNGNVVV
Storage
-20C
Provider Type Product Number
- No reagents -