H00010891-M12

PPARGC1A antibody from Abnova Corporation
PGC-1alpha, PGC1, PGC1A, PPARGC1

Antibody data

Product number
H00010891-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010891-M12, RRID:AB_1137386
Product name
PPARGC1A monoclonal antibody (M12), clone 3G11
Provider product page
Abnova Corporation - H00010891-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.
Antigen sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYR
YTCDAFAALENGYTLRRSNETDFELYFCGRKQFFK
SNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQ
RSLRR
Isotype
IgG
Antibody clone number
3G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -