H00027079-B01

RPUSD2 antibody from Abnova Corporation
C15orf19, C18B11, FLJ31409, PUS9

Antibody data

Product number
H00027079-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027079-B01, RRID:AB_1137831
Product name
RPUSD2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00027079-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RPUSD2 protein.
Antigen sequence
MWLDRRGWLRVLGHWRYDLRRPSFTRTWSGDKGPM
AETVSTQVGTEGGLRASHQQNGDAGGDAKVELSPG
PPKPAGREVEPAPVGGEHPSAAAPGPGKHKKRRGA
TRERVVPPPKKRRTGVSFGDEHFAETSYYFEGGLR
KVRPYYFDFRTYCKGRWVGHSLLHVFSTEFRAQPL
AYYEAAVRAGRLQLNEKPVQDLNIVLKDNDFLRNT
VHRHEPPVTAEPIRLLAENEDVVVVDKPSSIPVHP
CGRFRHNTVIFILGKEHQLKELHPLHRLDRLTSGV
LMFAKTAAVSERIHEQVRDRQLEKEYVCRVEGEFP
TEEVTCKEPILVVSYKVGVCRVDPRGKPCETVFQR
LSYNGQSSVVRCRPLTGRTHQIRVHLQFLGHPILN
DPIYNSVAWGPSRGRGGYIPKTNEELLRDLVAEHQ
AKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLE
ELAAAAQKMEEVAEAAPQELDTIALASEKAVETDV
MNQETDPLCAECRLVRQDPLPQDLVMFLHALRYKG
PGFEYFSPMPAWAQDDWQKD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -