Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056852-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056852-M01, RRID:AB_530192
- Product name
- RAD18 monoclonal antibody (M01), clone 3H7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAD18.
- Antigen sequence
EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAG
MSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNH
FSQSKLDSPEELEPDREEDSSSCIDIQEV- Isotype
- IgG
- Antibody clone number
- 3H7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks.
Elevated expression of Rad18 regulates melanoma cell proliferation.
Phosphorylation of human INO80 is involved in DNA damage tolerance.
NBS1 recruits RAD18 via a RAD6-like domain and regulates Pol η-dependent translesion DNA synthesis.
Tumour suppressor ING1b maintains genomic stability upon replication stress.
Differential roles for DNA polymerases eta, zeta, and REV1 in lesion bypass of intrastrand versus interstrand DNA cross-links.
WRN participates in translesion synthesis pathway through interaction with NBS1.
Sy SM, Jiang J, O WS, Deng Y, Huen MS
Nucleic acids research 2013 Oct;41(18):8572-80
Nucleic acids research 2013 Oct;41(18):8572-80
Elevated expression of Rad18 regulates melanoma cell proliferation.
Wong RP, Aguissa-Touré AH, Wani AA, Khosravi S, Martinka M, Martinka M, Li G
Pigment cell & melanoma research 2012 Mar;25(2):213-8
Pigment cell & melanoma research 2012 Mar;25(2):213-8
Phosphorylation of human INO80 is involved in DNA damage tolerance.
Kato D, Waki M, Umezawa M, Aoki Y, Utsugi T, Ohtsu M, Murakami Y
Biochemical and biophysical research communications 2012 Jan 6;417(1):433-8
Biochemical and biophysical research communications 2012 Jan 6;417(1):433-8
NBS1 recruits RAD18 via a RAD6-like domain and regulates Pol η-dependent translesion DNA synthesis.
Yanagihara H, Kobayashi J, Tateishi S, Kato A, Matsuura S, Tauchi H, Yamada K, Takezawa J, Sugasawa K, Masutani C, Hanaoka F, Weemaes CM, Mori T, Zou L, Komatsu K
Molecular cell 2011 Sep 2;43(5):788-97
Molecular cell 2011 Sep 2;43(5):788-97
Tumour suppressor ING1b maintains genomic stability upon replication stress.
Wong RP, Lin H, Khosravi S, Piche B, Jafarnejad SM, Chen DW, Li G
Nucleic acids research 2011 May;39(9):3632-42
Nucleic acids research 2011 May;39(9):3632-42
Differential roles for DNA polymerases eta, zeta, and REV1 in lesion bypass of intrastrand versus interstrand DNA cross-links.
Hicks JK, Chute CL, Paulsen MT, Ragland RL, Howlett NG, Guéranger Q, Glover TW, Canman CE
Molecular and cellular biology 2010 Mar;30(5):1217-30
Molecular and cellular biology 2010 Mar;30(5):1217-30
WRN participates in translesion synthesis pathway through interaction with NBS1.
Kobayashi J, Okui M, Asaithamby A, Burma S, Chen BP, Tanimoto K, Matsuura S, Komatsu K, Chen DJ
Mechanisms of ageing and development 2010 Jun;131(6):436-44
Mechanisms of ageing and development 2010 Jun;131(6):436-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAD18 expression in transfected 293T cell line by RAD18 monoclonal antibody (M01), clone 3H7.Lane 1: RAD18 transfected lysate(56.2 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAD18 monoclonal antibody (M01), clone 3H7. Western Blot analysis of RAD18 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAD18 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 25 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RAD18 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol