HPA003266

SNCAIP antibody from Sigma-Aldrich
SYPH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003266
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003266, RRID:AB_1080163
Product name
Anti-SNCAIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003266
Antibody type
Polyclonal
Antigen
Synphilin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KILRQLLGKEISENVCTQEKLSLEFQDAQASSRNS
KKIPLEKRELKLARLRQLMQRSLSESDTDSNNSED
PKTTPVRKADRPRPQPIVESVESMDSAESLHLMIK
KHTL
Storage
-20C
Provider Type Product Number
- No reagents -