Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182629 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Autoimmune Regulator (AIRE) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AIRE antibody: synthetic peptide directed towards the N terminal of human AIRE
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
DFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPR
KGRKP PAVPKALVPP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Subcellular expression of autoimmune regulator is organized in a spatiotemporal manner.
Akiyoshi H, Hatakeyama S, Pitkänen J, Mouri Y, Doucas V, Kudoh J, Tsurugaya K, Uchida D, Matsushima A, Oshikawa K, Nakayama KI, Shimizu N, Peterson P, Matsumoto M
The Journal of biological chemistry 2004 Aug 6;279(32):33984-91
The Journal of biological chemistry 2004 Aug 6;279(32):33984-91
No comments: Submit comment
No validations: Submit validation data