HPA003267

CD2AP antibody from Atlas Antibodies
CMS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003267
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003267, RRID:AB_888267
Product name
Anti-CD2AP
Provider product page
Atlas Antibodies - HPA003267
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDS
ETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIG
FGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSL
GPKTQSVEITKTDTEGKIKAKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -