HPA003267

CD2AP antibody from Sigma-Aldrich
CMS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003267
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003267, RRID:AB_1078458
Product name
Anti-CD2AP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003267
Antibody type
Polyclonal
Antigen
CD2-associated protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDS
ETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIG
FGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSL
GPKTQSVEITKTDTEGKIKAKE
Storage
-20C
Provider Type Product Number
- No reagents -