Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024200 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024200, RRID:AB_1856730
- Product name
- Anti-SERPINB7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KAVAMMHQERKFNLSVIEDPSMKILELRYNGGINM
YVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYV
EVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADL
SGIASGGRLYISRMMHKSYIEVTEEGT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mutations in SERPINB7, encoding a member of the serine protease inhibitor superfamily, cause Nagashima-type palmoplantar keratosis.
Kubo A, Shiohama A, Sasaki T, Nakabayashi K, Kawasaki H, Atsugi T, Sato S, Shimizu A, Mikami S, Tanizaki H, Uchiyama M, Maeda T, Ito T, Sakabe J, Heike T, Okuyama T, Kosaki R, Kosaki K, Kudoh J, Hata K, Umezawa A, Tokura Y, Ishiko A, Niizeki H, Kabashima K, Mitsuhashi Y, Amagai M
American journal of human genetics 2013 Nov 7;93(5):945-56
American journal of human genetics 2013 Nov 7;93(5):945-56
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skin and kidney tissues using Anti-SERPINB7 antibody. Corresponding SERPINB7 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows low expression as expected.
- Sample type
- HUMAN