HPA003546

FSCB antibody from Atlas Antibodies
C14orf155, DKFZP434F1017
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003546
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003546, RRID:AB_1668321
Product name
Anti-FSCB
Provider product page
Atlas Antibodies - HPA003546
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVEN
VSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKI
NSVLKDLSNTNDGQAPT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -