HPA003546

FSCB antibody from Atlas Antibodies
C14orf155, DKFZP434F1017
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003546
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003546, RRID:AB_1845561
Product name
Anti-FSCB
Provider product page
Atlas Antibodies - HPA003546
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVEN
VSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKI
NSVLKDLSNTNDGQAPT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -