HPA003546

FSCB antibody from Sigma-Aldrich
C14orf155, DKFZP434F1017
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003546
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003546, RRID:AB_1845561
Product name
Anti-C14orf155 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003546
Antibody type
Polyclonal
Antigen
Fibrous sheath CABYR-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADLLLTEEFPIGEASAEVSPPPSEQTPEDEALVEN
VSTEFQSPQVAGIPAVKLGSVVLEGEAKFEEVSKI
NSVLKDLSNTNDGQAPT
Storage
-20C
Provider Type Product Number
- No reagents -