Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405970 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Adenylate Kinase 1 (AK1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AK1 antibody: synthetic peptide directed towards the N terminal of human AK1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
HLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLE
TVLDM LRDAMVAKVN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Ectoadenylate kinase and plasma membrane ATP synthase activities of human vascular endothelial cells.
Quillen EE, Haslam GC, Samra HS, Amani-Taleshi D, Knight JA, Wyatt DE, Bishop SC, Colvert KK, Richter ML, Kitos PA
The Journal of biological chemistry 2006 Jul 28;281(30):20728-37
The Journal of biological chemistry 2006 Jul 28;281(30):20728-37
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting