HPA006456

AK1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006456
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006456, RRID:AB_1078116
Product name
Anti-AK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006456
Antibody type
Polyclonal
Antigen
Adenylate kinase isoenzyme 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYP
REVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLK
RGETSGRVDDNEETIKKRLETYYKATEPVIAFYEK
RGIVRKVNAEGS
Storage
-20C
Provider Type Product Number
- No reagents -