HPA000988

KLHL28 antibody from Sigma-Aldrich
BTBD5, FLJ20081
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000988
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000988, RRID:AB_1845480
Product name
Anti-KLHL28 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000988
Antibody type
Polyclonal
Antigen
Kelch-like protein 28 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QNFEAVCQTEEFFELTHADLDEIVSNDCLNVATEE
TVFYALESWIKYDVQERQKYLAQLLNSVRLPLLSV
KFLTRLYEANHLIRDDRTCKHLLNEALKYHFMPEH
RLSHQTVLMTRPRCAPKVLCAVGGKSGLFACL
Storage
-20C
Provider Type Product Number
- No reagents -