HPA021798

SIRT5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021798
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021798, RRID:AB_1856911
Product name
Anti-SIRT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021798
Antibody type
Polyclonal
Antigen
NAD-dependent deacetylase sirtuin-5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQV
AARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPE
AL
Storage
-20C
Provider Type Product Number
- No reagents -