Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005539 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005539, RRID:AB_1078164
- Product name
- Anti-KANK1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
INVCGVRKRSYSAGNASQLEQLSRARRSGGELYID
YEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQD
SSCEASSELRENGECRSVAVGAEENMNDIVVYHRG
SRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADK
EIE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references KANK deficiency leads to podocyte dysfunction and nephrotic syndrome
Gee H, Zhang F, Ashraf S, Kohl S, Sadowski C, Vega-Warner V, Zhou W, Lovric S, Fang H, Nettleton M, Zhu J, Hoefele J, Weber L, Podracka L, Boor A, Fehrenbach H, Innis J, Washburn J, Levy S, Lifton R, Otto E, Han Z, Hildebrandt F
Journal of Clinical Investigation 2015 June;125(6):2375-2384
Journal of Clinical Investigation 2015 June;125(6):2375-2384
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and kANK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407129).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN