HPA005539

KANK1 antibody from Atlas Antibodies
ANKRD15, KANK, KIAA0172
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005539
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005539, RRID:AB_888196
Product name
Anti-KANK1
Provider product page
Atlas Antibodies - HPA005539
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
INVCGVRKRSYSAGNASQLEQLSRARRSGGELYID
YEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQD
SSCEASSELRENGECRSVAVGAEENMNDIVVYHRG
SRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADK
EIE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -