HPA005539

KANK1 antibody from Atlas Antibodies
ANKRD15, KANK, KIAA0172
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005539
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005539, RRID:AB_1078164
Product name
Anti-KANK1
Provider product page
Atlas Antibodies - HPA005539
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
INVCGVRKRSYSAGNASQLEQLSRARRSGGELYID
YEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQD
SSCEASSELRENGECRSVAVGAEENMNDIVVYHRG
SRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADK
EIE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -