HPA005539

KANK1 antibody from Sigma-Aldrich
ANKRD15, KANK, KIAA0172
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005539
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005539, RRID:AB_1078164
Product name
Anti-KANK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005539
Antibody type
Polyclonal
Antigen
KN motif and ankyrin repeat domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INVCGVRKRSYSAGNASQLEQLSRARRSGGELYID
YEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQD
SSCEASSELRENGECRSVAVGAEENMNDIVVYHRG
SRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADK
EIE
Storage
-20C
Provider Type Product Number
- No reagents -