HPA020071

DUSP8 antibody from Sigma-Aldrich
C11orf81, FLJ42958, HB5, HVH-5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020071
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020071, RRID:AB_1847903
Product name
Anti-DUSP8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020071
Antibody type
Polyclonal
Antigen
Dual specificity protein phosphatase 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLL
AALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSE
SAATGNAAAR
Storage
-20C
Provider Type Product Number
- No reagents -