HPA005547

TNS3 antibody from MilliporeSigma / Merck KGaA
FLJ13732, H_NH0549I23.2, TEM6, TENS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005547
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005547, RRID:AB_1080322
Product name
Anti-TNS3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005547
Antibody type
Polyclonal
Antigen
tensin 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPD
LGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQ
MQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEAR
Storage
-20C
Provider Type Product Number
- No reagents -