WH0008812M1

CCNK antibody from MilliporeSigma / Merck KGaA
CPR4
ELISA
Recommended by provider

Antibody data

Product number
WH0008812M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0008812M1, RRID:AB_1841110
Product name
Monoclonal Anti-CCNK antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0008812M1
Antibody type
Monoclonal
Antigen
CCNK (AAH15935, a.a. 1-355) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTP
SQLEGLDPATEARYRREGARFIFDVGTRLGLHYDT
LATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGK
VEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEV
MVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDK
NKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAV
MYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVD
VLEDICHQIL (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -