Antibody data

Product number
H00008812-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008812-M01, RRID:AB_425784
Product name
CCNK monoclonal antibody (M01), clone 3B7-1B9
Provider product page
Abnova Corporation - H00008812-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant CCNK.
Antigen sequence
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTP
SQLEGLDPATEARYRREGARFIFDVGTRLGLHYDT
LATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGK
VEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEV
MVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDK
NKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAV
MYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVD
VLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQ
PTPQVPQVQQSQPSQSSEPSQPQQKDPLILLQGWA
CRQPATHLLPSPLEDSLLCPRPFPHPACLQLGGWG
GQPG
Isotype
IgG
Antibody clone number
3B7-1B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -