Antibody data

Product number
H00008812-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008812-M03, RRID:AB_1112262
Product name
CCNK monoclonal antibody (M03), clone S1
Provider product page
Abnova Corporation - H00008812-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CCNK.
Antigen sequence
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTP
SQLEGLDPATEARYRREGARFIFDVGTRLGLHYDT
LATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGK
VEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEV
MVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDK
NKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAV
MYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVD
VLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQ
PTPQVPQVQQSQPSQSSEPSQPQQKDPLILLQGWA
CRQPATHLLPSPLEDSLLCPRPFPHPACLQLGGWG
GQPG
Isotype
IgG
Antibody clone number
S1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -