HPA018447

HSCB antibody from Sigma-Aldrich
DNAJC20, HSC20, Jac1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018447
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018447, RRID:AB_1853867
Product name
Anti-HSCB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018447
Antibody type
Polyclonal
Antigen
Co-chaperone protein HscB, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKE
FTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIK
LKK
Storage
-20C
Provider Type Product Number
- No reagents -