HPA003711

NPNT antibody from Sigma-Aldrich
EGFL6L, POEM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003711
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003711, RRID:AB_1854591
Product name
Anti-NPNT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003711
Antibody type
Polyclonal
Antigen
Nephronectin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDEC
SLGQYQCSSFARCYNVRGSYKCKCKEGYQGDGLTC
VYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIP
DVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK
Storage
-20C
Provider Type Product Number
- No reagents -