HPA004131

CD300LG antibody from Sigma-Aldrich
CLM9, Trem4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004131
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004131, RRID:AB_1078459
Product name
Anti-CD300LG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004131
Antibody type
Polyclonal
Antigen
triggering receptor expressed on myeloid cells 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQE
TMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCG
VEKRGPDESLLISLFVFPGSSRPPMQLDSTSAEDT
SPALSSGSSKPR
Storage
-20C
Provider Type Product Number
- No reagents -