Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010410-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010410-M01, RRID:AB_425846
- Product name
- IFITM3 monoclonal antibody (M01), clone 4C8-1B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant IFITM3.
- Antigen sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAP
HNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNP
CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKC
LNIWALILGILMTILLIVIPVLIFQAYG- Isotype
- IgG
- Antibody clone number
- 4C8-1B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references KLF4-mediated negative regulation of IFITM3 expression plays a critical role in colon cancer pathogenesis.
Interactions between PBEF and oxidative stress proteins--a potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.
Gene-expression profiling in Chinese patients with colon cancer by coupling experimental and bioinformatic genomewide gene-expression analyses: identification and validation of IFITM3 as a biomarker of early colon carcinogenesis.
Li D, Peng Z, Tang H, Wei P, Kong X, Yan D, Huang F, Li Q, Le X, Li Q, Xie K
Clinical cancer research : an official journal of the American Association for Cancer Research 2011 Jun 1;17(11):3558-68
Clinical cancer research : an official journal of the American Association for Cancer Research 2011 Jun 1;17(11):3558-68
Interactions between PBEF and oxidative stress proteins--a potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.
Zhang LQ, Adyshev DM, Singleton P, Li H, Cepeda J, Huang SY, Zou X, Verin AD, Tu J, Garcia JG, Ye SQ
FEBS letters 2008 Jun 11;582(13):1802-8
FEBS letters 2008 Jun 11;582(13):1802-8
Gene-expression profiling in Chinese patients with colon cancer by coupling experimental and bioinformatic genomewide gene-expression analyses: identification and validation of IFITM3 as a biomarker of early colon carcinogenesis.
Fan J, Peng Z, Zhou C, Qiu G, Tang H, Sun Y, Wang X, Li Q, Le X, Xie K
Cancer 2008 Jul 15;113(2):266-75
Cancer 2008 Jul 15;113(2):266-75
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IFITM3 monoclonal antibody (M01), clone 4C8-1B10 Western Blot analysis of IFITM3 expression in Hela ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IFITM3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol