Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010410-B02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010410-B02, RRID:AB_1113993
- Product name
- IFITM3 MaxPab mouse polyclonal antibody (B02)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human IFITM3 protein.
- Antigen sequence
MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGP
HNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNP
CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKC
LNIWALILGILMTILLIVIPVLIFQAYG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The N-terminal region of IFITM3 modulates its antiviral activity by regulating IFITM3 cellular localization.
Evidence for Alteration of Gene Regulatory Networks through MicroRNAs of the HIV-infected brain: novel analysis of retrospective cases.
Jia R, Pan Q, Ding S, Rong L, Liu SL, Geng Y, Qiao W, Liang C
Journal of virology 2012 Dec;86(24):13697-707
Journal of virology 2012 Dec;86(24):13697-707
Evidence for Alteration of Gene Regulatory Networks through MicroRNAs of the HIV-infected brain: novel analysis of retrospective cases.
Tatro ET, Scott ER, Nguyen TB, Salaria S, Banerjee S, Moore DJ, Masliah E, Achim CL, Everall IP
PloS one 2010 Apr 26;5(4):e10337
PloS one 2010 Apr 26;5(4):e10337
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- IFITM3 MaxPab polyclonal antibody. Western Blot analysis of IFITM3 expression in human placenta.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of IFITM3 expression in transfected 293T cell line (H00010410-T02) by IFITM3 MaxPab polyclonal antibody.Lane 1: IFITM3 transfected lysate(14.63 KDa).Lane 2: Non-transfected lysate.
