HPA004337

IFITM3 antibody from Sigma-Aldrich
1-8U
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004337
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004337, RRID:AB_1851427
Product name
Anti-IFITM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004337
Antibody type
Polyclonal
Antigen
Interferon-induced transmembrane protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAP
HNPAPPTSTVIHIRSETSVPDH
Storage
-20C
Provider Type Product Number
- No reagents -