HPA023899

SAXO1 antibody from Sigma-Aldrich
C9orf138, FAM154A, MGC35182
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023899
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023899, RRID:AB_1845813
Product name
Anti-FAM154A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023899
Antibody type
Polyclonal
Antigen
Protein FAM154A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHLPINTKSCKPHWSGPRGNVPVESQTTYTISFTP
KEMGRCLASYPEPPGYTFEEVDALGHRIYKPVSQA
GSQQSSHLSVDDSENPNQRELEVLA
Storage
-20C
Provider Type Product Number
- No reagents -