HPA020965

HAUS6 antibody from Atlas Antibodies
dgt6, FAM29A, FLJ20060, KIAA1574
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020965
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020965, RRID:AB_1848394
Product name
Anti-HAUS6
Provider product page
Atlas Antibodies - HPA020965
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGI
SSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEAN
FKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -