HPA020965

HAUS6 antibody from Atlas Antibodies
dgt6, FAM29A, FLJ20060, KIAA1574

Antibody data

Product number
HPA020965
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020965, RRID:AB_1848394
Product name
Anti-HAUS6
Provider product page
Atlas Antibodies - HPA020965
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGI
SSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEAN
FKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.