HPA020965

HAUS6 antibody from Sigma-Aldrich
dgt6, FAM29A, FLJ20060, KIAA1574
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020965
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020965, RRID:AB_1848394
Product name
Anti-FAM29A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020965
Antibody type
Polyclonal
Antigen
Protein FAM29A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEEFMKILDHLEVSCNKPSTNKTMLWNSFQISSGI
SSKSFKDNDFGILHETLPEEVGHLSFNSSSSSEAN
FKLEPNSPMHGGTLLEDVVGGRQTTPESDFNLQ
Storage
-20C
Provider Type Product Number
- No reagents -