HPA024311

RPH3AL antibody from MilliporeSigma / Merck KGaA
Noc2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024311
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024311, RRID:AB_1856429
Product name
Anti-RPH3AL antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024311
Antibody type
Polyclonal
Antigen
Rab effector Noc2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEA
ILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMG
NG
Storage
-20C
Provider Type Product Number
- No reagents -