Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28579 - Provider product page

- Provider
- Abnova Corporation
- Product name
- ALDOB polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant ALDOB.
- Antigen sequence
KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAA
VPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLS
FSYGRALQASALAAWGGKAANKEATQEAFMKRAMA
NCQAAKGQYVHTGSSGAA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of human liver using ALDOB polyclonal antibody (Cat # PAB28579).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of A-431 cell line with ALDOB polyclonal antibody (Cat # PAB28579) shows positivity in nuclei but not nucleoli. Fixation/Permeabilization: PFA/Triton X-106
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human liver with ALDOB polyclonal antibody (Cat # PAB28579) shows strong cytoplasmic and nuclear positivity in hepatocytes.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)