Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002198 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002198, RRID:AB_1078129
- Product name
- Anti-ALDOB
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAA
VPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLS
FSYGRALQASALAAWGGKAANKEATQEAFMKRAMA
NCQAAKGQYVHTGSSGAA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The human liver-specific proteome defined by transcriptomics and antibody-based profiling
Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution.
Kampf C, Mardinoglu A, Fagerberg L, Hallstrom B, Edlund K, Lundberg E, Ponten F, Nielsen J, Uhlen M
The FASEB Journal 2014 June;28(7):2901-2914
The FASEB Journal 2014 June;28(7):2901-2914
Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution.
Merkulova M, Hurtado-Lorenzo A, Hosokawa H, Zhuang Z, Brown D, Ausiello DA, Marshansky V
American journal of physiology. Cell physiology 2011 Jun;300(6):C1442-55
American journal of physiology. Cell physiology 2011 Jun;300(6):C1442-55
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and tonsil tissues using HPA002198 antibody. Corresponding ALDOB RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in proximal tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
- Sample type
- HUMAN