HPA002198

ALDOB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002198
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002198, RRID:AB_1078129
Product name
Anti-ALDOB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002198
Antibody type
Polyclonal
Antigen
Fructose-bisphosphate aldolase B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAA
VPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLS
FSYGRALQASALAAWGGKAANKEATQEAFMKRAMA
NCQAAKGQYVHTGSSGAA
Storage
-20C
Provider Type Product Number
- No reagents -