Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023583 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023583, RRID:AB_1853122
- Product name
- Anti-C17orf97
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLR
WDGILADPEAEKERIRIYKLNRRKRYRCLALKGFH
PDPEALKGFHPDPEALKGFHPDP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Liat1, an arginyltransferase-binding protein whose evolution among primates involved changes in the numbers of its 10-residue repeats.
Brower CS, Rosen CE, Jones RH, Wadas BC, Piatkov KI, Varshavsky A
Proceedings of the National Academy of Sciences of the United States of America 2014 Nov 18;111(46):E4936-45
Proceedings of the National Academy of Sciences of the United States of America 2014 Nov 18;111(46):E4936-45
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subsets of seminiferus duct cells.
- Sample type
- HUMAN