Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP54432_P050 - Provider product page

- Provider
- Aviva Systems Biology
- Product name
- C17orf97 Antibody (ARP54432_P050)
- Antibody type
- Polyclonal
- Antigen
- The immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Horse
- Host
- Rabbit
- Vial size
- 100 μl
- Concentration
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Storage
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data