HPA023583

C17orf97 antibody from Sigma-Aldrich
LOC400566
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023583
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023583, RRID:AB_1853122
Product name
Anti-C17orf97 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023583
Antibody type
Polyclonal
Antigen
Uncharacterized protein C17orf97 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKVEKKHLPSDSSTVSLPDFAEIENLANRINESLR
WDGILADPEAEKERIRIYKLNRRKRYRCLALKGFH
PDPEALKGFHPDPEALKGFHPDP
Storage
-20C
Provider Type Product Number
- No reagents -