HPA007993

IGF2 antibody from Sigma-Aldrich
C11orf43, FLJ44734, IGF-II
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007993
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007993, RRID:AB_1851474
Product name
Anti-IGF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007993
Antibody type
Polyclonal
Antigen
Insulin-like growth factor II precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRS
CDLALLETYCATPAKSERDVSTPPTVLPDNFPRYP
VGKFFQYDTWKQSTQRLRRGLPALLRARRGHVLAK
ELEAFREAKRHRPLIALPTQD
Storage
-20C
Provider Type Product Number
- No reagents -