HPA002242

CALR antibody from Sigma-Aldrich
cC1qR, CRT, FLJ26680, RO, SSA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002242
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002242, RRID:AB_1078384
Product name
Anti-CALR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002242
Antibody type
Polyclonal
Antigen
Calreticulin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGP
DICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFT
HLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLP
PKKIKDPDASKPEDWDERAKIDDPTDS
Storage
-20C
Provider Type Product Number
- No reagents -