HPA015096

DENND4C antibody from Sigma-Aldrich
bA513M16.3, C9orf55, C9orf55B, FLJ20686
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015096
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015096, RRID:AB_1845831
Product name
Anti-DENND4C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015096
Antibody type
Polyclonal
Antigen
DENN domain-containing protein 4C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETNRDYSFPAGLEDHILGENISPNTSISGLVPSEL
TQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQ
DFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCR
ACGALVYDEEIMA
Storage
-20C
Provider Type Product Number
- No reagents -