HPA015096

DENND4C antibody from Atlas Antibodies
bA513M16.3, C9orf55, C9orf55B, FLJ20686, RAB10GEF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015096
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015096, RRID:AB_1845831
Product name
Anti-DENND4C
Provider product page
Atlas Antibodies - HPA015096
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ETNRDYSFPAGLEDHILGENISPNTSISGLVPSEL
TQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQ
DFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCR
ACGALVYDEEIMA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -